1. Packages
  2. Packages
  3. Fortimanager Provider
  4. API Docs
  5. ObjectFirewallVipgrpDynamicMapping
Viewing docs for fortimanager 1.17.0
published on Monday, May 4, 2026 by fortinetdev
Viewing docs for fortimanager 1.17.0
published on Monday, May 4, 2026 by fortinetdev

    Configure IPv4 virtual IP groups.

    This resource is a sub resource for variable dynamic_mapping of resource fortimanager.ObjectFirewallVipgrp. Conflict and overwrite may occur if use both of them.

    Create ObjectFirewallVipgrpDynamicMapping Resource

    Resources are created with functions called constructors. To learn more about declaring and configuring resources, see Resources.

    Constructor syntax

    new ObjectFirewallVipgrpDynamicMapping(name: string, args: ObjectFirewallVipgrpDynamicMappingArgs, opts?: CustomResourceOptions);
    @overload
    def ObjectFirewallVipgrpDynamicMapping(resource_name: str,
                                           args: ObjectFirewallVipgrpDynamicMappingInitArgs,
                                           opts: Optional[ResourceOptions] = None)
    
    @overload
    def ObjectFirewallVipgrpDynamicMapping(resource_name: str,
                                           opts: Optional[ResourceOptions] = None,
                                           vipgrp: Optional[str] = None,
                                           _scopes: Optional[Sequence[ObjectFirewallVipgrpDynamicMapping_ScopeArgs]] = None,
                                           adom: Optional[str] = None,
                                           color: Optional[float] = None,
                                           comments: Optional[str] = None,
                                           dynamic_sort_subtable: Optional[str] = None,
                                           interface: Optional[str] = None,
                                           member: Optional[str] = None,
                                           object_firewall_vipgrp_dynamic_mapping_id: Optional[str] = None,
                                           scopetype: Optional[str] = None,
                                           update_if_exist: Optional[bool] = None,
                                           uuid: Optional[str] = None)
    func NewObjectFirewallVipgrpDynamicMapping(ctx *Context, name string, args ObjectFirewallVipgrpDynamicMappingArgs, opts ...ResourceOption) (*ObjectFirewallVipgrpDynamicMapping, error)
    public ObjectFirewallVipgrpDynamicMapping(string name, ObjectFirewallVipgrpDynamicMappingArgs args, CustomResourceOptions? opts = null)
    public ObjectFirewallVipgrpDynamicMapping(String name, ObjectFirewallVipgrpDynamicMappingArgs args)
    public ObjectFirewallVipgrpDynamicMapping(String name, ObjectFirewallVipgrpDynamicMappingArgs args, CustomResourceOptions options)
    
    type: fortimanager:ObjectFirewallVipgrpDynamicMapping
    properties: # The arguments to resource properties.
    options: # Bag of options to control resource's behavior.
    
    
    resource "fortimanager_objectfirewallvipgrpdynamicmapping" "name" {
        # resource properties
    }

    Parameters

    name string
    The unique name of the resource.
    args ObjectFirewallVipgrpDynamicMappingArgs
    The arguments to resource properties.
    opts CustomResourceOptions
    Bag of options to control resource's behavior.
    resource_name str
    The unique name of the resource.
    args ObjectFirewallVipgrpDynamicMappingInitArgs
    The arguments to resource properties.
    opts ResourceOptions
    Bag of options to control resource's behavior.
    ctx Context
    Context object for the current deployment.
    name string
    The unique name of the resource.
    args ObjectFirewallVipgrpDynamicMappingArgs
    The arguments to resource properties.
    opts ResourceOption
    Bag of options to control resource's behavior.
    name string
    The unique name of the resource.
    args ObjectFirewallVipgrpDynamicMappingArgs
    The arguments to resource properties.
    opts CustomResourceOptions
    Bag of options to control resource's behavior.
    name String
    The unique name of the resource.
    args ObjectFirewallVipgrpDynamicMappingArgs
    The arguments to resource properties.
    options CustomResourceOptions
    Bag of options to control resource's behavior.

    Constructor example

    The following reference example uses placeholder values for all input properties.

    var objectFirewallVipgrpDynamicMappingResource = new Fortimanager.ObjectFirewallVipgrpDynamicMapping("objectFirewallVipgrpDynamicMappingResource", new()
    {
        Vipgrp = "string",
        _scopes = new[]
        {
            new Fortimanager.Inputs.ObjectFirewallVipgrpDynamicMapping_ScopeArgs
            {
                Name = "string",
                Vdom = "string",
            },
        },
        Adom = "string",
        Color = 0,
        Comments = "string",
        DynamicSortSubtable = "string",
        Interface = "string",
        Member = "string",
        ObjectFirewallVipgrpDynamicMappingId = "string",
        Scopetype = "string",
        UpdateIfExist = false,
        Uuid = "string",
    });
    
    example, err := fortimanager.NewObjectFirewallVipgrpDynamicMapping(ctx, "objectFirewallVipgrpDynamicMappingResource", &fortimanager.ObjectFirewallVipgrpDynamicMappingArgs{
    	Vipgrp: pulumi.String("string"),
    	_scopes: fortimanager.ObjectFirewallVipgrpDynamicMapping_ScopeArray{
    		&fortimanager.ObjectFirewallVipgrpDynamicMapping_ScopeArgs{
    			Name: pulumi.String("string"),
    			Vdom: pulumi.String("string"),
    		},
    	},
    	Adom:                                 pulumi.String("string"),
    	Color:                                pulumi.Float64(0),
    	Comments:                             pulumi.String("string"),
    	DynamicSortSubtable:                  pulumi.String("string"),
    	Interface:                            pulumi.String("string"),
    	Member:                               pulumi.String("string"),
    	ObjectFirewallVipgrpDynamicMappingId: pulumi.String("string"),
    	Scopetype:                            pulumi.String("string"),
    	UpdateIfExist:                        pulumi.Bool(false),
    	Uuid:                                 pulumi.String("string"),
    })
    
    resource "fortimanager_objectfirewallvipgrpdynamicmapping" "objectFirewallVipgrpDynamicMappingResource" {
      vipgrp = "string"
      _scopes {
        name = "string"
        vdom = "string"
      }
      adom                                      = "string"
      color                                     = 0
      comments                                  = "string"
      dynamic_sort_subtable                     = "string"
      interface                                 = "string"
      member                                    = "string"
      object_firewall_vipgrp_dynamic_mapping_id = "string"
      scopetype                                 = "string"
      update_if_exist                           = false
      uuid                                      = "string"
    }
    
    var objectFirewallVipgrpDynamicMappingResource = new ObjectFirewallVipgrpDynamicMapping("objectFirewallVipgrpDynamicMappingResource", ObjectFirewallVipgrpDynamicMappingArgs.builder()
        .vipgrp("string")
        ._scopes(ObjectFirewallVipgrpDynamicMapping_ScopeArgs.builder()
            .name("string")
            .vdom("string")
            .build())
        .adom("string")
        .color(0.0)
        .comments("string")
        .dynamicSortSubtable("string")
        .interface_("string")
        .member("string")
        .objectFirewallVipgrpDynamicMappingId("string")
        .scopetype("string")
        .updateIfExist(false)
        .uuid("string")
        .build());
    
    object_firewall_vipgrp_dynamic_mapping_resource = fortimanager.ObjectFirewallVipgrpDynamicMapping("objectFirewallVipgrpDynamicMappingResource",
        vipgrp="string",
        _scopes=[{
            "name": "string",
            "vdom": "string",
        }],
        adom="string",
        color=float(0),
        comments="string",
        dynamic_sort_subtable="string",
        interface="string",
        member="string",
        object_firewall_vipgrp_dynamic_mapping_id="string",
        scopetype="string",
        update_if_exist=False,
        uuid="string")
    
    const objectFirewallVipgrpDynamicMappingResource = new fortimanager.ObjectFirewallVipgrpDynamicMapping("objectFirewallVipgrpDynamicMappingResource", {
        vipgrp: "string",
        _scopes: [{
            name: "string",
            vdom: "string",
        }],
        adom: "string",
        color: 0,
        comments: "string",
        dynamicSortSubtable: "string",
        "interface": "string",
        member: "string",
        objectFirewallVipgrpDynamicMappingId: "string",
        scopetype: "string",
        updateIfExist: false,
        uuid: "string",
    });
    
    type: fortimanager:ObjectFirewallVipgrpDynamicMapping
    properties:
        _scopes:
            - name: string
              vdom: string
        adom: string
        color: 0
        comments: string
        dynamicSortSubtable: string
        interface: string
        member: string
        objectFirewallVipgrpDynamicMappingId: string
        scopetype: string
        updateIfExist: false
        uuid: string
        vipgrp: string
    

    ObjectFirewallVipgrpDynamicMapping Resource Properties

    To learn more about resource properties and how to use them, see Inputs and Outputs in the Architecture and Concepts docs.

    Inputs

    In Python, inputs that are objects can be passed either as argument classes or as dictionary literals.

    The ObjectFirewallVipgrpDynamicMapping resource accepts the following input properties:

    Vipgrp string
    Vipgrp.
    Adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    Color double
    Integer value to determine the color of the icon in the GUI (range 1 to 32, default = 0, which sets the value to 1).
    Comments string
    Comment.
    DynamicSortSubtable string
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    Interface string
    Interface.
    Member string
    Member VIP objects of the group (Separate multiple objects with a space).
    ObjectFirewallVipgrpDynamicMappingId string
    an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
    Scopetype string
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    UpdateIfExist bool
    Uuid string
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    _scopes List<ObjectFirewallVipgrpDynamicMapping_Scope>
    _Scope. The structure of _scope block is documented below.
    Vipgrp string
    Vipgrp.
    Adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    Color float64
    Integer value to determine the color of the icon in the GUI (range 1 to 32, default = 0, which sets the value to 1).
    Comments string
    Comment.
    DynamicSortSubtable string
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    Interface string
    Interface.
    Member string
    Member VIP objects of the group (Separate multiple objects with a space).
    ObjectFirewallVipgrpDynamicMappingId string
    an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
    Scopetype string
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    UpdateIfExist bool
    Uuid string
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    _scopes []ObjectFirewallVipgrpDynamicMapping_ScopeArgs
    _Scope. The structure of _scope block is documented below.
    vipgrp string
    Vipgrp.
    _scopes list(object)
    _Scope. The structure of _scope block is documented below.
    adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    color number
    Integer value to determine the color of the icon in the GUI (range 1 to 32, default = 0, which sets the value to 1).
    comments string
    Comment.
    dynamic_sort_subtable string
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    interface string
    Interface.
    member string
    Member VIP objects of the group (Separate multiple objects with a space).
    object_firewall_vipgrp_dynamic_mapping_id string
    an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
    scopetype string
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    update_if_exist bool
    uuid string
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    vipgrp String
    Vipgrp.
    _scopes List<ObjectFirewallVipgrpDynamicMapping_Scope>
    _Scope. The structure of _scope block is documented below.
    adom String
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    color Double
    Integer value to determine the color of the icon in the GUI (range 1 to 32, default = 0, which sets the value to 1).
    comments String
    Comment.
    dynamicSortSubtable String
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    interface_ String
    Interface.
    member String
    Member VIP objects of the group (Separate multiple objects with a space).
    objectFirewallVipgrpDynamicMappingId String
    an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
    scopetype String
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    updateIfExist Boolean
    uuid String
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    vipgrp string
    Vipgrp.
    _scopes ObjectFirewallVipgrpDynamicMapping_Scope[]
    _Scope. The structure of _scope block is documented below.
    adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    color number
    Integer value to determine the color of the icon in the GUI (range 1 to 32, default = 0, which sets the value to 1).
    comments string
    Comment.
    dynamicSortSubtable string
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    interface string
    Interface.
    member string
    Member VIP objects of the group (Separate multiple objects with a space).
    objectFirewallVipgrpDynamicMappingId string
    an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
    scopetype string
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    updateIfExist boolean
    uuid string
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    vipgrp str
    Vipgrp.
    _scopes Sequence[ObjectFirewallVipgrpDynamicMapping_ScopeArgs]
    _Scope. The structure of _scope block is documented below.
    adom str
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    color float
    Integer value to determine the color of the icon in the GUI (range 1 to 32, default = 0, which sets the value to 1).
    comments str
    Comment.
    dynamic_sort_subtable str
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    interface str
    Interface.
    member str
    Member VIP objects of the group (Separate multiple objects with a space).
    object_firewall_vipgrp_dynamic_mapping_id str
    an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
    scopetype str
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    update_if_exist bool
    uuid str
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    vipgrp String
    Vipgrp.
    _scopes List<Property Map>
    _Scope. The structure of _scope block is documented below.
    adom String
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    color Number
    Integer value to determine the color of the icon in the GUI (range 1 to 32, default = 0, which sets the value to 1).
    comments String
    Comment.
    dynamicSortSubtable String
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    interface String
    Interface.
    member String
    Member VIP objects of the group (Separate multiple objects with a space).
    objectFirewallVipgrpDynamicMappingId String
    an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
    scopetype String
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    updateIfExist Boolean
    uuid String
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).

    Outputs

    All input properties are implicitly available as output properties. Additionally, the ObjectFirewallVipgrpDynamicMapping resource produces the following output properties:

    Id string
    The provider-assigned unique ID for this managed resource.
    Id string
    The provider-assigned unique ID for this managed resource.
    id string
    The provider-assigned unique ID for this managed resource.
    id String
    The provider-assigned unique ID for this managed resource.
    id string
    The provider-assigned unique ID for this managed resource.
    id str
    The provider-assigned unique ID for this managed resource.
    id String
    The provider-assigned unique ID for this managed resource.

    Look up Existing ObjectFirewallVipgrpDynamicMapping Resource

    Get an existing ObjectFirewallVipgrpDynamicMapping resource’s state with the given name, ID, and optional extra properties used to qualify the lookup.

    public static get(name: string, id: Input<ID>, state?: ObjectFirewallVipgrpDynamicMappingState, opts?: CustomResourceOptions): ObjectFirewallVipgrpDynamicMapping
    @staticmethod
    def get(resource_name: str,
            id: str,
            opts: Optional[ResourceOptions] = None,
            _scopes: Optional[Sequence[ObjectFirewallVipgrpDynamicMapping_ScopeArgs]] = None,
            adom: Optional[str] = None,
            color: Optional[float] = None,
            comments: Optional[str] = None,
            dynamic_sort_subtable: Optional[str] = None,
            interface: Optional[str] = None,
            member: Optional[str] = None,
            object_firewall_vipgrp_dynamic_mapping_id: Optional[str] = None,
            scopetype: Optional[str] = None,
            update_if_exist: Optional[bool] = None,
            uuid: Optional[str] = None,
            vipgrp: Optional[str] = None) -> ObjectFirewallVipgrpDynamicMapping
    func GetObjectFirewallVipgrpDynamicMapping(ctx *Context, name string, id IDInput, state *ObjectFirewallVipgrpDynamicMappingState, opts ...ResourceOption) (*ObjectFirewallVipgrpDynamicMapping, error)
    public static ObjectFirewallVipgrpDynamicMapping Get(string name, Input<string> id, ObjectFirewallVipgrpDynamicMappingState? state, CustomResourceOptions? opts = null)
    public static ObjectFirewallVipgrpDynamicMapping get(String name, Output<String> id, ObjectFirewallVipgrpDynamicMappingState state, CustomResourceOptions options)
    resources:  _:    type: fortimanager:ObjectFirewallVipgrpDynamicMapping    get:      id: ${id}
    import {
      to = fortimanager_objectfirewallvipgrpdynamicmapping.example
      id = "${id}"
    }
    
    name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    state
    Any extra arguments used during the lookup.
    opts
    A bag of options that control this resource's behavior.
    resource_name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    state
    Any extra arguments used during the lookup.
    opts
    A bag of options that control this resource's behavior.
    name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    state
    Any extra arguments used during the lookup.
    opts
    A bag of options that control this resource's behavior.
    name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    state
    Any extra arguments used during the lookup.
    opts
    A bag of options that control this resource's behavior.
    The following state arguments are supported:
    Adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    Color double
    Integer value to determine the color of the icon in the GUI (range 1 to 32, default = 0, which sets the value to 1).
    Comments string
    Comment.
    DynamicSortSubtable string
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    Interface string
    Interface.
    Member string
    Member VIP objects of the group (Separate multiple objects with a space).
    ObjectFirewallVipgrpDynamicMappingId string
    an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
    Scopetype string
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    UpdateIfExist bool
    Uuid string
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    Vipgrp string
    Vipgrp.
    _scopes List<ObjectFirewallVipgrpDynamicMapping_Scope>
    _Scope. The structure of _scope block is documented below.
    Adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    Color float64
    Integer value to determine the color of the icon in the GUI (range 1 to 32, default = 0, which sets the value to 1).
    Comments string
    Comment.
    DynamicSortSubtable string
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    Interface string
    Interface.
    Member string
    Member VIP objects of the group (Separate multiple objects with a space).
    ObjectFirewallVipgrpDynamicMappingId string
    an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
    Scopetype string
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    UpdateIfExist bool
    Uuid string
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    Vipgrp string
    Vipgrp.
    _scopes []ObjectFirewallVipgrpDynamicMapping_ScopeArgs
    _Scope. The structure of _scope block is documented below.
    _scopes list(object)
    _Scope. The structure of _scope block is documented below.
    adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    color number
    Integer value to determine the color of the icon in the GUI (range 1 to 32, default = 0, which sets the value to 1).
    comments string
    Comment.
    dynamic_sort_subtable string
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    interface string
    Interface.
    member string
    Member VIP objects of the group (Separate multiple objects with a space).
    object_firewall_vipgrp_dynamic_mapping_id string
    an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
    scopetype string
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    update_if_exist bool
    uuid string
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    vipgrp string
    Vipgrp.
    _scopes List<ObjectFirewallVipgrpDynamicMapping_Scope>
    _Scope. The structure of _scope block is documented below.
    adom String
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    color Double
    Integer value to determine the color of the icon in the GUI (range 1 to 32, default = 0, which sets the value to 1).
    comments String
    Comment.
    dynamicSortSubtable String
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    interface_ String
    Interface.
    member String
    Member VIP objects of the group (Separate multiple objects with a space).
    objectFirewallVipgrpDynamicMappingId String
    an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
    scopetype String
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    updateIfExist Boolean
    uuid String
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    vipgrp String
    Vipgrp.
    _scopes ObjectFirewallVipgrpDynamicMapping_Scope[]
    _Scope. The structure of _scope block is documented below.
    adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    color number
    Integer value to determine the color of the icon in the GUI (range 1 to 32, default = 0, which sets the value to 1).
    comments string
    Comment.
    dynamicSortSubtable string
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    interface string
    Interface.
    member string
    Member VIP objects of the group (Separate multiple objects with a space).
    objectFirewallVipgrpDynamicMappingId string
    an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
    scopetype string
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    updateIfExist boolean
    uuid string
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    vipgrp string
    Vipgrp.
    _scopes Sequence[ObjectFirewallVipgrpDynamicMapping_ScopeArgs]
    _Scope. The structure of _scope block is documented below.
    adom str
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    color float
    Integer value to determine the color of the icon in the GUI (range 1 to 32, default = 0, which sets the value to 1).
    comments str
    Comment.
    dynamic_sort_subtable str
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    interface str
    Interface.
    member str
    Member VIP objects of the group (Separate multiple objects with a space).
    object_firewall_vipgrp_dynamic_mapping_id str
    an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
    scopetype str
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    update_if_exist bool
    uuid str
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    vipgrp str
    Vipgrp.
    _scopes List<Property Map>
    _Scope. The structure of _scope block is documented below.
    adom String
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    color Number
    Integer value to determine the color of the icon in the GUI (range 1 to 32, default = 0, which sets the value to 1).
    comments String
    Comment.
    dynamicSortSubtable String
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    interface String
    Interface.
    member String
    Member VIP objects of the group (Separate multiple objects with a space).
    objectFirewallVipgrpDynamicMappingId String
    an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
    scopetype String
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    updateIfExist Boolean
    uuid String
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    vipgrp String
    Vipgrp.

    Supporting Types

    ObjectFirewallVipgrpDynamicMapping_Scope, ObjectFirewallVipgrpDynamicMapping_ScopeArgs

    Name string
    Name.
    Vdom string
    Vdom.
    Name string
    Name.
    Vdom string
    Vdom.
    name string
    Name.
    vdom string
    Vdom.
    name String
    Name.
    vdom String
    Vdom.
    name string
    Name.
    vdom string
    Vdom.
    name str
    Name.
    vdom str
    Vdom.
    name String
    Name.
    vdom String
    Vdom.

    Import

    ObjectFirewall VipgrpDynamicMapping can be imported using any of these accepted formats:

    Set import_options = [“vipgrp=YOUR_VALUE”] in the provider section.

    $ export “FORTIMANAGER_IMPORT_TABLE”=“true”

    $ pulumi import fortimanager:index/objectFirewallVipgrpDynamicMapping:ObjectFirewallVipgrpDynamicMapping labelname {{_scope.name}}.{{_scope.vdom}}
    

    $ unset “FORTIMANAGER_IMPORT_TABLE”

    -> Hint: The scopetype and adom for import will directly inherit the scopetype and adom configuration of the provider.

    To learn more about importing existing cloud resources, see Importing resources.

    Package Details

    Repository
    fortimanager fortinetdev/terraform-provider-fortimanager
    License
    Notes
    This Pulumi package is based on the fortimanager Terraform Provider.
    Viewing docs for fortimanager 1.17.0
    published on Monday, May 4, 2026 by fortinetdev
      Try Pulumi Cloud free. Your team will thank you.